Domain assignment for gi|238921396|ref|YP_002934911.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 397 PLP-dependent transferases 9.55e-107 AAT-like 0.000000000185 3tat A: Alignments

Protein Sequence Details

Sequence length 400
Comment aromatic-amino-acid aminotransferase [Edwardsiella ictaluri 93-146]
Sequence
MFEHVDDYAGDPILSLMESYKRDARAQKVNLSIGLYYDLRGEVPMLASVATALARLNAAAPAAPLYLPMEGMADYRSAVQSLLLGADHPALRARRVATIQTLGGSGALKVGADFLRRYFPRAEVWVSDPTWDNHVAIFEGAGFRVHRYPYFDPQTLSVCFGAMLETLELLPPYSIVLLHPCCHNPTGSDLTLAQWDRLTSLLRRRALIPFLDIAYQGFGSGMDQDAYAIRTMAAVGLPCLVSNSFSKIFSLYGERVGGLSVMCSDEAEAGRVLGQLKAMVRRNYSSPPLHGAALVAAVLNDTDLQCQWREEVEAMRLRIIAMRGQLASRLNLALPSRRFDYLCQQRGMFSYTGLSAHQVGELRRHDGVYLVGSGRMCMAGLNESNLDRVAAALVRVMALQ

Download

Sequence (FASTA)