Domain assignment for gi|238921370|ref|YP_002934885.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
90 294 Periplasmic binding protein-like II 4.56e-40 Phosphate binding protein-like 0.00028 1i6a A: Alignments
1 85 "Winged helix" DNA-binding domain 6.36e-25 LysR-like transcriptional regulators 0.0044 1ixc A:1-89 Alignments

Protein Sequence Details

Sequence length 312
Comment transcriptional regulator, LysR family [Edwardsiella ictaluri 93-146]
Sequence
MDVRTLRYFVEVVRQHSFTRAAEKLFVTQPTISKMLRNLEEELGCTLLIREGRGLRLTDSGNVVYQRAQTILDQFGQLRTELDDLGALKKGSLKLGIPPMVGTQMAGLIGEFRQRYPGIELHIAEFGGLTVEQAVLSGELDLALTALSAQPDPAIASLPLFSHPLYVLLPRQAPWLTRSALGMTDLAQQNILLYNEDFALYQQLMQAFSAAGVKPQIAVRSGQWDFLAAMVQAGVGIAILPQPICQRLDPHSLLWLPLAPTLMWRLGLIWCHGRYLSHSAQAWIARCREFWPERDMHPERLTQHGNGTPPTA

Download

Sequence (FASTA)