Domain assignment for gi|238921348|ref|YP_002934863.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
398 628 EAL domain-like 3.92e-30 EAL domain 0.024 2bas A:2-262 Alignments
229 380 Nucleotide cyclase 0.0000000000000062 GGDEF domain 0.0044 1w25 A:294-455 Alignments

Protein Sequence Details

Sequence length 630
Comment cyclic diguanylate cyclase/phosphodiesterase domain protein [Edwardsiella ictaluri 93-146]
Sequence
MRITTKFFAFTTLLVVLGMFLMLLGSTYSFYSQTHQRAEIQLNILTAMIDQQLLTESRDSVKRWLPVMMRSAGAVELSVYHDGSQVYYHHLPALYNPWRTDDNLRSFESPLLQHPGYRLKLVYIEPTDSYSHSLERMFPLSLSIGVMVIMLFIAYRWLRRQTLGIERLDRRSRRILSGDRDLRVGGVGEFPASVSSALDCLLSELSDACEERSRIDSLIRAFAAQDSRTGLNNRLFFDNQLTTLLEDEGAHGVVMILRLPDLETLVSQPGRRQREEFRYALTNMLSTYVMRYPSGLLAHYFQNNFAVLLPHRSLKEAEGFAAQLLASLAAIPSAPGVSTDEVLHIGITLYRAGEQVESVMDRAEQAARSATLQGGNGWFVDKTPQPEMVRGSVRWRTLLEQTLARGGARLFHKPAVTVDGRVHHHYILPYIYDGNQPILSAEFMPLVQQLGLAERFDRQMVSQIIPLLRRLPGQRLAFPLTVDSLLQRSFQRWLRDTLLQSERLLRRRILIELSEADVCAHQARLGPILRLLRGLECQIVVSQAGLRIVSTTYIKQLQVALVKLHPALVRNIDRRIENQLFVQSITGACEGTVAQVFATGVRSKEEWRVLREKGIAGGQGDFFAKSRPVL

Download

Sequence (FASTA)