Domain assignment for gi|238921328|ref|YP_002934843.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
76 384 PLP-dependent transferases 6.74e-45 Cystathionine synthase-like 0.023 1gc0 A: Alignments

Protein Sequence Details

Sequence length 463
Comment L-seryl-tRNA selenium transferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MSSDSQVLYSQIPAIDTLLRTPACAALQAQYGSQLVTQALRSLQQQARHAIQRQQALPDWCVDWGVACTRRLAETLQPAMRRVFNLTGTVLHTNLGRALLPDTAIAAAAGAMGAPVTLEYDLDDAGRGHRDRAIADRLCALTGAEDACIVNNNAAAVLLMLATLAPGRDVIVSRGELVEIGGAFRIPDVMTQAGCRLREVGTTNRTHLHDYRQAIGEHSALLMKVHTSNYAIAGFTAAVSEAELAALGQEYGLPVISDLGSGSLLDMAHYGLPAEPMPQRMLADGVDLVSFSGDKLLGGPQAGIIVGRRELIHRLQRHPLKRALRCGKMTLAALDATLQLYQQPEKLRQALPTLRHLTREASEIAACGERLLARLRPHYEEAFVLTLEPCLSQIGSGSLPVDRLPSHAITLTPRDGRGGTLTALADRWRALPCPVIGRLQEGKLWLDLRCLDDEQALLQELCQ

Download

Sequence (FASTA)