Domain assignment for gi|238921274|ref|YP_002934789.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 141 Resolvase-like 2.09e-40 gamma,delta resolvase, catalytic domain 0.00014 2gm4 A:1-140 Alignments
144 186 Homeodomain-like 0.0000215 Recombinase DNA-binding domain 0.058 1hcr A: Alignments

Protein Sequence Details

Sequence length 190
Comment resolvase family protein [Edwardsiella ictaluri 93-146]
Sequence
MTEIQIGYARCSTDKQDLTAQQETLAKLGVSPDRIYTDKGLTGSNRQRPGLDQALAAVRSGDTLVVPKLDRLARSVADAREIADALQARGVKLALGTRIYDPTDPMGKMFFNVLATFAEFEDGLIRLRTREGMAIARAKGKLRGKQPKLSDKQQQELCRMHGSGEYSISDLAELFSVSRPTVYRTLSRGK

Download

Sequence (FASTA)