Domain assignment for gi|238921230|ref|YP_002934745.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 301 Arginase/deacetylase 5.58e-92 Arginase-like amidino hydrolases 0.00000241 1gq6 A: Alignments

Protein Sequence Details

Sequence length 304
Comment agmatinase, putative [Edwardsiella ictaluri 93-146]
Sequence
MCTLGHKPDNSLVSNAFGFLRLPLDFMPYDGDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEGKRWPWNFDMRDRLKVVDCGDVVFSFGDAQEMSDNLQAHAERLLASGKRCLTFGGDHFITLPLLRAHAKHFGKMALVHFDAHTDTYAHGSKFDHGTMFFHAPNEGLIDPQHSVQIGIRTEYDHDNGFTVLDAAQVNDRSVEDVLAEVKRIVGDLPVYLTFDIDCLDPAHAPGTGTPVIGGLTSDRALKLVRGLQDLDIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKK

Download

Sequence (FASTA)