Domain assignment for gi|238921204|ref|YP_002934719.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
15 244 Folate-binding domain 1.73e-56 Aminomethyltransferase folate-binding domain 0.000000508 1nrk A:1-243 Alignments
246 326 Aminomethyltransferase beta-barrel domain 3.2e-19 Aminomethyltransferase beta-barrel domain 0.0000762 1nrk A:244-325 Alignments

Protein Sequence Details

Sequence length 331
Comment folate-binding protein YgfZ [Edwardsiella ictaluri 93-146]
Sequence
MNLNAPFSPQPPLAAEHLPLTLMRLDDWLPINVSGPDAQSYLQGQLTADLPSLAATQHTLCGHCDAQGKLWSSLRLLRRRDGFTYLLRRSVATLQMLELKKYAVFAKASIVSDEGAVLLGVAGAQASEALGALFPRLPDADAPLLQAGRSHLLYMAWPQPRYLLICDDADEAERIFAPLSARARLADSAQWLALDIESGIPLIDEPNCDSFLPQAVNLQALGGISFTKGCYSGQEMVARAKYRGANRRALFWLRGSAERLPHASEDLELRLGDSWRRSGTVLAAQRLADGGVYLQAVLSSDLPADSVLRVRDDARSQLTLSPLPYSTDQQE

Download

Sequence (FASTA)