Domain assignment for gi|238921194|ref|YP_002934709.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 182 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.49e-17 Extradiol dioxygenases 0.077 1lkd A:133-288 Alignments

Protein Sequence Details

Sequence length 189
Comment glyoxalase family protein [Edwardsiella ictaluri 93-146]
Sequence
MNFCGLGHINVVVDDIDVATEFYTRVLSAIPQQDFPYFKNAGFSKAAGFLDEPESVNVSIRFLEIPGTPVFLELMQYHSPISESYIRDKKVNDIGGVGHICLRVNDIDNAFTFIKKQSDVKLVSVSDEYKPFKIDPITPDEFYFFDASKNNKVEKDNVCNVIGEIRFFYFLDPYGIQWEFEQGHVDISS

Download

Sequence (FASTA)