Domain assignment for gi|238921142|ref|YP_002934657.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
136 346 P-loop containing nucleoside triphosphate hydrolases 1.57e-33 G proteins 0.021 1xzp A:212-371 Alignments

Protein Sequence Details

Sequence length 352
Comment hydrogenase accessory protein HypB, putative [Edwardsiella ictaluri 93-146]
Sequence
MCTTCGCAAGELHIEGDEHHHAHRHDSDGHAHHHGHHHHGHRHESQDAARVVNVHHHYHHNGDVHHHYHYVFATPEQAQQHAHSHEHNHGHHHDHAHEHGHSHAEETAFAPHQHHDDLDYGHGEAGAHAPGISQRRMVQIEQDVLSKNNALAEHNREHFTRQHIAALNLVSSPGSGKTTLLTETLKRIASRFPCAVIEGDQQTTNDAERIRATGVSAIQVNTGKGCHLDAQMVHDAMHRLALPDHSLLFIENVGNLVCPASFDLGERHKVAVLSVTEGEDKPLKYPHMFAASSLMIINKIDLLPYLQFDVDACIANARRINPQIQVIQLSATSGEGMDAWLAWLETTLGENQ

Download

Sequence (FASTA)