Domain assignment for gi|238921063|ref|YP_002934578.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 143 Ribonuclease H-like 2.53e-57 Ribonuclease H 0.000000608 1f21 A: Alignments

Protein Sequence Details

Sequence length 154
Comment ribonuclease HI, putative [Edwardsiella ictaluri 93-146]
Sequence
MLKQVEIFTDGSCLGNPGPGGYGAILRYRQHEKALSAGYRLTTNNRMELMAAIVALETLTSACQVALFSDSQYVRQGITQWIHGWKRRDWKTADKKPVKNVDLWQRLDQAIGPHQVEWIWIKGHAGHPENERCDELARRAAGTPTQDDSGYTPG

Download

Sequence (FASTA)