Domain assignment for gi|238921062|ref|YP_002934577.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 182 Ribonuclease H-like 4.49e-54 DnaQ-like 3'-5' exonuclease 0.000000113 1j54 A: Alignments

Protein Sequence Details

Sequence length 243
Comment DNA polymerase III, epsilon subunit, putative [Edwardsiella ictaluri 93-146]
Sequence
MSIPIARQIVLDTETTGMNQVGAHYEGHRIIEIGAVEVVNRRLTGRNFHVYLKPDRLVDPEAFTVHGISDDFLLDKPSFAEVADEFLAFIRGAELVIHNAPFDIGFMDYEFAKLGRDLPKTETFCTITDSLVMARRLFPGKRNSLDALCNRYEIDNSKRTLHGALLDAQILADVYLIMTGGQTLLAFSSDGDGASQSQASEIRRVVRGAKGLRVVYASEVELAAHEQRLDLVQKKGDSCLWRS

Download

Sequence (FASTA)