Domain assignment for gi|238921056|ref|YP_002934571.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 259 Carbohydrate phosphatase 2.75e-85 Inositol monophosphatase/fructose-1,6-bisphosphatase-like 0.0000256 2hhm A: Alignments

Protein Sequence Details

Sequence length 267
Comment Inositol monophosphatase family protein [Edwardsiella ictaluri 93-146]
Sequence
MHPMLNIAVRAARKAGNLIAKSYETPDSIEASQKGSNDFVTNVDRDAEHLIIETIRKSYPKHTIISEECGELLGEDHEIQWVIDPLDGTTNFVKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELYTATRGQGAQLNGYRLRTGVAKDLDGTILATGFPFKMKHHAATYIKMVDKLFTQCADFRRTGSAALDLAYVAAGRVDGFFEIGLKPWDFAAGELLVREAGGLVTDFVGGHGYLASGNVVAGNPRVVKSLLGALRDELSDALKR

Download

Sequence (FASTA)