Domain assignment for gi|238921050|ref|YP_002934565.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
77 170 HSC20 (HSCB), C-terminal oligomerisation domain 5.62e-21 HSC20 (HSCB), C-terminal oligomerisation domain 0.0000972 1fpo A:77-171 Alignments
1 75 Chaperone J-domain 3.14e-17 Chaperone J-domain 0.0000536 1fpo A:1-76 Alignments

Protein Sequence Details

Sequence length 172
Comment Fe-S protein assembly co-chaperone HscB, putative [Edwardsiella ictaluri 93-146]
Sequence
MDYFTLFGFPARYDVDGSLLAARFQDLQRQFHPDRFVTAPERDRLLAMQQATTINDAYQTLKHPLKRAEYLLSLHGFDINNEQQTLRDTAFLIEQMTLREELEVLEHRADADEALMSFSDKVAKMVQVRSAQMINELDCQAWPQAADSVRKLRFLDRLQQQTEQLEERLLGM

Download

Sequence (FASTA)