Domain assignment for gi|238921006|ref|YP_002934521.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 251 S-adenosyl-L-methionine-dependent methyltransferases 1.11e-63 N6 adenine-specific DNA methylase, DAM 0.00058 2dpm A: Alignments

Protein Sequence Details

Sequence length 252
Comment DNA adenine methylase, putative [Edwardsiella ictaluri 93-146]
Sequence
MNTLPVIPWIGGKRRLAKHILPLFPEHRCYVEPFCGAAALFFMKKPTQVEVLNDINGDVTNLYRVLQHHLEEFVRQFKWSLVSREMYRWLQITPEETLTDIQRAARFYYLQKLAFGGKVENRTFGTATTSPPRLNLLRMEEDLSAAHLRLTRVCIENLDWADCIRRYDRPHTLFYCDPPYWKTEGYGVSFGLELYLRMAELARTMQGRMIISVNDIPEMRNIFHGLTFSTVEIRYTVGGKPASATSELIIQN

Download

Sequence (FASTA)