Domain assignment for gi|238920965|ref|YP_002934480.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 499 MFS general substrate transporter 9.81e-71 LacY-like proton/sugar symporter 0.027 1pv7 A: Alignments

Protein Sequence Details

Sequence length 511
Comment drug resistance MFS transporter, drug:H+ antiporter-1 family [Edwardsiella ictaluri 93-146]
Sequence
MQQKPLEGAKLAWMTIALSMATFMQVLDSTIANVAIPTISGNLGASNSQGTWVITSFGVANAISIPITGWLAKRFGEVRLFLWSTGLFALTSWLCGVSQSLEMLILFRVLQGLVAGPLIPLSQSLLLGNYPPAKRNMALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPLGIGVVLVSMSTLKGRETRIEHKPIDTVGLILLALGVGCLQVMLDKGKELDWFNSSEIILLTVVAVVSLIFLLIWEMTDDHPVVDLSLFKIRNFTIGVLSISLAYMFYFGAIVLLPLLLQEVYGYTATWAGLASAPVGLIPVLLSPIIGRFGARLDMRRLVTFSFIMYAVCFYWRAYSFEPGMDFGASAWPQFVQGFAVACFFMPLTTISLSGLPPERIAAASSLSNFCRTLAGSIGVSITTTLWTRREALHHTHLTESITPYNPIAQQAYGEMEKLGLNSHQASALIAQDITAQGLIISANEIFWAAAGVFLVLLILIWFAKPPFSSAGDSGGAH

Download

Sequence (FASTA)