Domain assignment for gi|238920924|ref|YP_002934439.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
82 242 Ribonuclease H-like 6.2e-40 Retroviral integrase, catalytic domain 0.007 1c0m A:49-216 Alignments

Protein Sequence Details

Sequence length 251
Comment integrase core domain protein [Edwardsiella ictaluri 93-146]
Sequence
MMQSRTVYNYRSCRDDRAVTLRIREIAETRIRYGVQRIHILLRREGWLINHKKTHRIYCQEGLNLRTKRPRRHVTARQRSVRPEVTAIDQCWSMDFVADNLFNGRRIRALTVVDNFSRECLAIHVGQGLRGEDVVTVMARLKALRQRVPERLQTDNGSEFISKALDHWAYENGITMDFSRPGKPTDNALIESFNGSVRDECLNVHWFLSLDDAQEKIEQWRQEYNRSRPHSSLNNQTPEEFIQILQKGPDL

Download

Sequence (FASTA)