Domain assignment for gi|238920915|ref|YP_002934430.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
27 181 OMPA-like 5.49e-23 Outer membrane protein 0.00046 1qj8 A: Alignments

Protein Sequence Details

Sequence length 181
Comment hypothetical protein NT01EI_3043 [Edwardsiella ictaluri 93-146]
Sequence
MKKMLVIPLIAAGFMVSTLALAETQTVSLGYAHIKPQEEKALNGAILGYRYEFDDDWGVLGNVTFAKGDTKETDDFAKGDFKYYSLMAGPTYRINEYISVYGQLGLAYFNAKFEANYDDGYSEHSSASVTALGWGAGFIVNPMDNLAITVGYEGSRFNFNGDNDGSKVSTNGFNVSLGYRF

Download

Sequence (FASTA)