Domain assignment for gi|238920865|ref|YP_002934380.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
35 127 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000502 Histidine kinase 0.02 1ysr A:299-446 Alignments

Protein Sequence Details

Sequence length 139
Comment hypothetical protein NT01EI_2991 [Edwardsiella ictaluri 93-146]
Sequence
MKLRTYSFPLAATLDSLTPLVAALQEFFSGAPSDVLSQLELAANESFSNIVHHGQAGAYPVMITLTRHPRHLEVVLRDRGQPLPDGALWPTVQGYRMNDPCCWPDHGLSILLIRQMTDEYHYRYSAGGNEQRLIKYHGG

Download

Sequence (FASTA)