Domain assignment for gi|238920859|ref|YP_002934374.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 46 Homeodomain-like 0.0000000591 Tetracyclin repressor-like, N-terminal domain 0.079 2i10 A:10-78 Alignments

Protein Sequence Details

Sequence length 51
Comment hypothetical protein NT01EI_2985 [Edwardsiella ictaluri 93-146]
Sequence
MKKSRSTEEQIVFALKQAELGTSVPDVCRKLGISAAIFYTWRKKYGGISPF

Download

Sequence (FASTA)