Domain assignment for gi|238920857|ref|YP_002934372.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
37 90 Ribonuclease H-like 0.00000285 Retroviral integrase, catalytic domain 0.042 1exq A: Alignments

Protein Sequence Details

Sequence length 97
Comment hypothetical protein NT01EI_2983 [Edwardsiella ictaluri 93-146]
Sequence
MNSRWDAKKALKESGYFSNNNKLAIDNINDDIIGGYNSVAESFFSSLKKERIRKCVYKTRELARTDIFDYIEAFYNRARRHSHPGGVSPEAFERASS

Download

Sequence (FASTA)