Domain assignment for gi|238920845|ref|YP_002934360.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
28 164 S-adenosyl-L-methionine-dependent methyltransferases 8.51e-21 Precorrin-6Y methyltransferase (CbiT) 0.03 1l3i A: Alignments

Protein Sequence Details

Sequence length 273
Comment Methyltransferase domain protein [Edwardsiella ictaluri 93-146]
Sequence
MLIDEIDFAALYRQQLTQAQRTAKPPAHWDRRAQAMSVTCAVPQDPYLQQLTAAMDLSRAQTLLDVGCGPGSVCLATAPRLRQAYGLDYSKGMLAVAALRAGHLNLDNVTLIQRAWEEPWDDIPRCDVVVASRSTLVDDLRPALAKLNRHARQWVYTTHPVSSSFVDPQILQAIGRPIRELPNYIYAVNILYQMGIHASVSFIGTPACQQHAATAAQFADAIALALGEVSLQERQALEAYYHHCRQRGRAPAGARRDWALIAWQPQPLTEDRE

Download

Sequence (FASTA)