Domain assignment for gi|238920841|ref|YP_002934356.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 431 MFS general substrate transporter 2.09e-77 Glycerol-3-phosphate transporter 0.04 1pw4 A: Alignments

Protein Sequence Details

Sequence length 438
Comment transporter, major facilitator superfamily [Edwardsiella ictaluri 93-146]
Sequence
MEQHKRFDDIRFTPVHRKIMLWGSGGPFLDGYVLVIIGIALEQLTPLLQLDANWIGMVGAATLVGLFIGTSLFGYVADRVGRRLMFLIDIIAIGVISAATMFVTSPLELVILRFLIGIVIGADYPIATSMIAEFSSTKQRAFTMGFIAAMWYIGATTADLVGYLLYDVENGWRWMLGSAIVPCIIILLGRVELPESPRWLIRKGRHAECRALMIKLFGQPVTFDDEAPQETRYRDIFSRRHLSSILFVAAIWTCQVIPMFAIYTFGPQIVTLLGLEQGREAVLGNVVISLFFMLGCLPAMYWLNSVGRRPLLIGSFAIMTLSLLMLGLVDQPGILLIVSAFALYAFFSGGPGILQWLYPNELFPTAIRASAVGAAMSLSRIGTVVSTYALPLFMQQHGISATMLAGAGISLFGLLISVMMAPETRGLSLEQTSRMKLF

Download

Sequence (FASTA)