Domain assignment for gi|238920830|ref|YP_002934345.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 261 ClpP/crotonase 1.14e-80 Crotonase-like 0.0000233 2dub A: Alignments

Protein Sequence Details

Sequence length 261
Comment enoyl-CoA hydratase/isomerase family protein [Edwardsiella ictaluri 93-146]
Sequence
MSESLQIARNGGVLEITLNRPKANAIDAKTSLAMGEAFIAFRDDPTLRVAIITGAGGRFFSAGWDLKAAAEGEAPDADFGPGGFAGLTELFNLDKPVIAAVNGYAFGGGFELALAADMIVCADNACFALPEARLGIVPDSGGMLRLPKCIPPAIANEMMMSGRRMEAEEALRWGIVNQVVPGDRLMETARALAQQVAESAPLALAALKEIVRATAELSVEEGYRLIRSGALKHYPAVLHSEDALEGPQAFAEKREPVWKGR

Download

Sequence (FASTA)