Domain assignment for gi|238920788|ref|YP_002934303.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
522 668 Duplicated hybrid motif 1.74e-51 Glucose permease-like 0.0000112 1gla F: Alignments
418 490 Glucose permease domain IIB 2.62e-17 Glucose permease domain IIB 0.00063 1o2f B: Alignments

Protein Sequence Details

Sequence length 671
Comment PTS system, N-acetylglucosamine-specific IIbc component, putative [Edwardsiella ictaluri 93-146]
Sequence
MSILGYLQKVGRALMVPVATLPAAAILMGVGYWIDPVGWGGDNALAAFFIKSGSAIIDNMSVLFAIGVAYGMSKDKDGAAALAGFVGFLVVTTLCSPAAVAMIQKIPVDQVPAAFGKINNQFIGILVGIISAELYNRYSSVELPKALSFFSGRRLVPILTSFLMIILAFILMYIWPVIFNGLVNFGEHIQKLGSVGAGVYAFFNRLLIPVGLHHALNSVFWFDVAGINDIPNFLGGAQSIESGKAVVGITGRYQAGFFPIMMFGLPGAALAIYHCARPENRAKVAGIMLAAAFASFFTGITEPLEFSFMFVAPVLYVLHAILTGISVFIAASMHWISGFGFSAGLVDMVLQSRNPLATHWYMLIPQGLVFFVIYYVVFRFTITKFNLMTPGRELSGAGEEADGNDEDLDLTKEADVSELARQYIACVGGSANLTGIDACITRLRLTVKDSSLVNEAMAKRLGASGVIRLNKTSVQIIVGFVAEKIANAMRTAGTVPAAAASSAAPAAKAQATPNAAAGVHSTLVSPITGEVVALSEVPDEAFASKAVGDGLAVRPTDKMVVAPANGTVVKIFNTNHAFCLESDDGVEVVVHMGIDTVALNGQGFKRLVEEGDVVKVGQPVLELDLDYLNAHARSMISPVVVSNIDDFGGVGALASGQVVAGQSKLYTILNK

Download

Sequence (FASTA)