Domain assignment for gi|238920764|ref|YP_002934279.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 85 NIF3 (NGG1p interacting factor 3)-like 2.22e-22 NIF3 (NGG1p interacting factor 3)-like 0.0000433 1nmo A: Alignments

Protein Sequence Details

Sequence length 88
Comment hypothetical protein NT01EI_2883 [Edwardsiella ictaluri 93-146]
Sequence
MDNLVLEQRINRLLDVDSMQDYAPNGLQVEGRREVQRIVTGVTACQALLDAAAAAGADAVLVHHGYFWKSESPTVRGMRRQRLKNAAG

Download

Sequence (FASTA)