Domain assignment for gi|238920718|ref|YP_002934233.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 421 PLP-dependent transferases 1.89e-132 GABA-aminotransferase-like 0.0000000000144 1qj5 A: Alignments

Protein Sequence Details

Sequence length 429
Comment adenosylmethionine-8-amino-7-oxononanoate transaminase, putative [Edwardsiella ictaluri 93-146]
Sequence
MNASDLDFDRRHIWHPYTSMSQPLPVYPVTTASGCELQLADGRRLVDGMSSWWAAIHGYNHPHLNQAVTRQLAQMAHVMFGGVTHPSAVALCQKLVGMTPQALECVFLADSGSVAVEVALKMALQYWQARGEPRQRFLTLRQGYHGDTFGAMSVCDPDTSMHSLYRGYLPQHLFAPAPQCAFNAEWDEADFVPFARLLAAHHRELAAVILEPIVQGAGGMRFYHPCYLQRVRQACSRHGVLLIADEIATGFGRSGALFACDHAKVTPDILCLGKALTGGYMTLAATLTTRSVADTISNGEAGCFMHGPTFMANPLACATAVASLELIEQGHWRAQVAAIESQLRAELLPLNAHPRIRQARVLGAIGVLETHQPVNMAALQAFFVEQGVWIRPFGHLIYLMPPYPITAVQLTQLTETIRAALAYDAHFST

Download

Sequence (FASTA)