Domain assignment for gi|238920687|ref|YP_002934202.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
94 290 Periplasmic binding protein-like II 5.61e-23 Phosphate binding protein-like 0.0027 1al3 A: Alignments
2 80 "Winged helix" DNA-binding domain 9.9e-16 LysR-like transcriptional regulators 0.017 1ixc A:1-89 Alignments

Protein Sequence Details

Sequence length 300
Comment transcriptional regulator, LysR family [Edwardsiella ictaluri 93-146]
Sequence
MRINLEVLLILDALDRHGSFAAAAQSLYKTPAALSYMVQKLESNLNLQLLDRSGHRARFTRSGRIILEKGRRLLSEAQELELQATLLESGWEMEIFIALEGYILPHTLDPVIGAFIQAHPHTRLHLMPHTPTHNGQSGEPGVMADIIIGTAPLLPENSDYTYQSLGYIDTLLAMTPDHPLSRSGHPLTPDQLGEQRTIVMGDRLAVSPATVGQETPQHIVVYDPAYQISLLLSGAGIGYLPRHAIRPYLTQRRLSAPPLTFTPAHEAAYVGWRHTKAGHAAQWWREHLLNGDLHPALFGD

Download

Sequence (FASTA)