Domain assignment for gi|238920683|ref|YP_002934198.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
61 111 Homeodomain-like 0.0000000000000851 AraC type transcriptional activator 0.0022 1d5y A:57-121 Alignments
10 59 Homeodomain-like 0.00000000000313 AraC type transcriptional activator 0.0018 1d5y A:3-56 Alignments

Protein Sequence Details

Sequence length 122
Comment transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MTTQGQHQLLVDALIQWIEQNLDKRILIDDIAERAGYSKWYLQRLFKEVTGYSLAAYVRKRRLIRAAAELQRSNKKIMEIMLQYGFDSQQTFSRAFKRRYGTSPGSYRQQADGDRCVALSPA

Download

Sequence (FASTA)