Domain assignment for gi|238920587|ref|YP_002934102.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 85 Homeodomain-like 8.24e-17 Cgl2762-like 0.059 2jn6 A:1-89 Alignments

Protein Sequence Details

Sequence length 116
Comment transposase, IS3/IS911 family protein [Edwardsiella ictaluri 93-146]
Sequence
MGTPRFTPEFKEEAVRQITERGYSVTEVSERLGVSAHSLYKWLRAIKPDNSEQYARDLLEAKTEILKLRAQLKHTEGERDILKQAETGTRVEEVCRKMGISEATFYIYGLPPFCKY

Download

Sequence (FASTA)