Domain assignment for gi|238920568|ref|YP_002934083.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
25 215 Periplasmic binding protein-like II 1.55e-27 Phosphate binding protein-like 0.0047 2fyi A:88-307 Alignments

Protein Sequence Details

Sequence length 230
Comment LysR-family transcriptional regulatory protein [Edwardsiella ictaluri 93-146]
Sequence
MQLLNYARKILRFNDEACHSLINDHLQGRLVVGATDDSADSILPQLLGRFTALYPKLAIDVRMQRNADIQLMLLDNEVDLAVSMGCEPSLSSTLLRRSPTVWFCATDYDFTPGIPIELVVLDEPSTFRSLATTALDAAGLPWRLAYVASTLPALRAALKAGLGISARPIEMMSSSLRVLGEAGGLPRLADTEYNLCLAPQCRNPLAVTLFDALREGDEGGVTTSRETDKD

Download

Sequence (FASTA)