Domain assignment for gi|238920536|ref|YP_002934051.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
18 280 ClpP/crotonase 6.69e-81 Crotonase-like 0.000000751 1q52 A: Alignments

Protein Sequence Details

Sequence length 285
Comment naphthoate synthase, putative [Edwardsiella ictaluri 93-146]
Sequence
MLYPSEQELYAPIAWQDCSGDFEDILYHKSADGIAKITINRPQVRNAFRPLTVKEMLQALADARYDDGIGVIVLTGAGDKAFCAGGDQKIRGDYGGYRDDSGVHHLNVLDFQRQIRTCPKPVVAMVAGYAVGGGHVLHMMCDLTIAAQNAQFGQTGPKVGSFDGGWGASYMARIVGQKKAREIWFLCRMYDAQQALDMGLVNTVVPLEDLEKETVRWCREMLRNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRQPDFSKFKRNP

Download

Sequence (FASTA)