Domain assignment for gi|238920535|ref|YP_002934050.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
105 306 Enolase C-terminal domain-like 1.7e-50 D-glucarate dehydratase-like 0.0000000968 1fhu A:100-320 Alignments
1 98 Enolase N-terminal domain-like 6.06e-27 Enolase N-terminal domain-like 0.0000643 1fhu A:1-99 Alignments

Protein Sequence Details

Sequence length 323
Comment O-succinylbenzoic acid synthetase, putative [Edwardsiella ictaluri 93-146]
Sequence
MRQATLYRYRLPVDAGVALRNQRLKSRDGLLVRLHEDGREGWGEIAPLPEFSHETLPEAQEAACRLLAQWQVGAAPAESPLPSVAFGLSCAQAELSGTLPQAANYRSATLCNGDPDALFQVLQSIPGEKVAKVKVGLYEAVRDGMIVNLLLEALPDLHLRLDANRSWTRAKADGFAKYVNPDWRDRILFLEEPCKTRDESRAFARDTGIAIAWDESVRDADFRVEAEPGVAAIIIKPTLTGSLQRCRQLVTQAHQAGLSAVISSSIESSLGLSQLARMAAWLTPGTPPGLDTLMLMQAQLLRAWPACTLPLWGEDTLDVVWQG

Download

Sequence (FASTA)