Domain assignment for gi|238920532|ref|YP_002934047.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 339 Nucleotidylyl transferase 2.08e-74 Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000355 1d2r A: Alignments

Protein Sequence Details

Sequence length 343
Comment tryptophanyl-tRNA synthetase, putative [Edwardsiella ictaluri 93-146]
Sequence
MPHLSSPNDAEQHICLSGDRPTGPLHLGHYVGSLRQRLTLQQRFPLYVMIADLQGLTDNGSQPQKVADNILQVMADYLAVGIDPQRATLCLQSALPALAELTMLYMNIVSVARVARNPTVKAEIAQKGFANSLPAGFLLYPISQAADITAFGADRIPVGDDQLPMLEQTNEIVQRMNTLLPQPVLRPCQAILSQVGRLPGIDGNAKMSKSLGNTLPLSADPAQIRAAVHAMYTDPAHLRVSDPGRVEGNVVFTYLDAFHPCAERVAEMKAHYRRGGLGDSQCKRELEECLQTLLAPIRQRRAELLADRAQLLQILQAGSERAREVSQQTLVAVKRGLGLPLMY

Download

Sequence (FASTA)