Domain assignment for gi|238920525|ref|YP_002934040.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
5 150 Molybdopterin synthase subunit MoaE 6.28e-53 Molybdopterin synthase subunit MoaE 0.000000398 1fm0 E: Alignments

Protein Sequence Details

Sequence length 150
Comment molybdopterin converting factor, subunit 2, putative [Edwardsiella ictaluri 93-146]
Sequence
MQDTQIVVSAAPFSVAEQYQWLAQRDEDGAVVTFSGKVRNHNLGDDVSALTLEHYPGMTEKALAEIVALARRRWPLGRIAVYHRVGPMFPGEEIVFVGVTSAHRGMAFEAAEFIMDYLKTRAPFWKRETSEGADRWVDARDSDRQAAERW

Download

Sequence (FASTA)