Domain assignment for gi|238920519|ref|YP_002934034.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
11 229 S-adenosyl-L-methionine-dependent methyltransferases 1.13e-46 CAC2371-like 0.071 1wzn A:1-251 Alignments

Protein Sequence Details

Sequence length 235
Comment 3-demethylubiquinone-9 3-O-methyltransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MSQNVDLQEIAKFEAVASRWWDPEGEFKPLHRINPLRLDYILQRADGLFAKRVLDVGCGGGILAESMAQAGAEVTGLDMGAEPLQVARLHALESGVTVNYLQETVEQHAGHTDALYDVITCMEMLEHVPDPRSVVLACARLVKPGGQIFFSTINRNPKAWLLMVLGAEYLLKMVPKGTHDPRKFIRPAELMAWLDSAPLTVRHLCGMHYNPLRDRFTLGRGVDVNYLLHACREAE

Download

Sequence (FASTA)