Domain assignment for gi|238920508|ref|YP_002934023.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
58 107 Homeodomain-like 0.000000000269 AraC type transcriptional activator 0.0046 1d5y A:57-121 Alignments
5 55 Homeodomain-like 0.0000000004 AraC type transcriptional activator 0.0016 1bl0 A:9-62 Alignments

Protein Sequence Details

Sequence length 117
Comment transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MYNTDFISALRTWIDSNVAAISSLDDVAARAGYSKWHLQRMFKAHTGVRLGEYIRNKKLDESARRLKVCQGSILDIALSMGFDSQRSFTRSFKRRFDVTPGVWKKEMTAGNPLDRAA

Download

Sequence (FASTA)