Domain assignment for gi|238920492|ref|YP_002934007.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 55 MFS general substrate transporter 0.0000249 LacY-like proton/sugar symporter 0.044 1pv7 A: Alignments

Protein Sequence Details

Sequence length 72
Comment bicyclomycin resistance protein (Sulfonamide resistance protein) [Edwardsiella ictaluri 93-146]
Sequence
MPLRADTLGFFCGQRVYGPRADSVGRNLVILFGTFLFALTGATCVLVHCIVLLACCGRCPCGDQCPDMRDVQ

Download

Sequence (FASTA)