Domain assignment for gi|238920484|ref|YP_002933999.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 245 Periplasmic binding protein-like II 5.98e-74 Phosphate binding protein-like 0.0000000121 1wdn A: Alignments

Protein Sequence Details

Sequence length 248
Comment extracellular solute-binding protein, family 3 [Edwardsiella ictaluri 93-146]
Sequence
MKAMLKASVAALALAFAVSAQAAEKPLIVATDTAFVPFEFKKGDKYVGFDIDLWDAIAKQLHLSYTLKPMDFSGIIPALQTRNVDLALAGISITEERKKAIDFSDGYYNSGLMVMVKSGNAQIHGVKDLDGKVLAVKSGTAGVDYAKAHVKSKDLRQFPNIDNAYLELATGRADAVLHDTPNILYFIQTAGNGQFKAVGDSLEAQAYGIAFPKGSDALRGQVNDALKTLKADGTYAAIYKKWFGVEPK

Download

Sequence (FASTA)