Domain assignment for gi|238920437|ref|YP_002933952.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
17 99 Homeodomain-like 0.000000000986 Recombinase DNA-binding domain 0.065 1gdt A:141-183 Alignments

Protein Sequence Details

Sequence length 126
Comment hypothetical protein NT01EI_2548 [Edwardsiella ictaluri 93-146]
Sequence
MPIIAPIPRDERRLMQKTIHKTHDKNYSRRLTAMLMLHRGDRVSDVARTLCCARSSVGRWINWFTLSGVAGLKSLPAGRARRWPFEHICSLLRELVKHAPGDFCYQRSRWSTELLTIKINGITGCQ

Download

Sequence (FASTA)