Domain assignment for gi|238920433|ref|YP_002933948.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
23 181 PEBP-like 1.26e-53 Prokaryotic PEBP-like proteins 0.000000516 1fux A: Alignments

Protein Sequence Details

Sequence length 183
Comment conserved hypothetical protein TIGR00481 [Edwardsiella ictaluri 93-146]
Sequence
MSKTTFSLAALALLSLPVHAQSFTLSSPEIQNGNQMSNQQVFAGFGCEGGNSSPALSWSGAPEGTKSFAITAYDPDAPTGSGWWHWTLVNIPADIHQLSAGAGAQDSTTLPAGAVQGRNDFGYAGFGGACPPPGDKPHRYQFTVWALKTDKLPIDNTSSGALVGFMLNANKLATAQLVPVYGH

Download

Sequence (FASTA)