Domain assignment for gi|238920423|ref|YP_002933938.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 69 Homeodomain-like 0.0000000376 Recombinase DNA-binding domain 0.058 1gdt A:141-183 Alignments

Protein Sequence Details

Sequence length 93
Comment hypothetical protein NT01EI_2534 [Edwardsiella ictaluri 93-146]
Sequence
MLMLHRGDRVSDVARTLCCARSSVGRWINWFTLSGVAGLKSLPAGRSRRWPFEHICSLLRELVKHAPDDFGYQRSRWSTELLTIKINEITGFQ

Download

Sequence (FASTA)