Domain assignment for gi|238920422|ref|YP_002933937.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
65 155 Ribonuclease H-like 0.0000278 Retroviral integrase, catalytic domain 0.036 1asu A: Alignments

Protein Sequence Details

Sequence length 183
Comment hypothetical protein NT01EI_2533 [Edwardsiella ictaluri 93-146]
Sequence
MAAIHKALNECSAEHPVFYEDEVDIHLNPKIGADWQLRGQQKRVVTPGQNEKYSLAGALHCGTGKVSYVGGNRKSSLLFIKLLKQLKAMYRRAKTITLIVDNYIIHKSRETQRWLKQNPKFRVIYPPVYSPWVNHVERLWQALHDTITRNHQCRSMWQLLKKARHFMEIVSPFPGGKHGLAKV

Download

Sequence (FASTA)