Domain assignment for gi|238920412|ref|YP_002933927.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 242 Periplasmic binding protein-like II 2.59e-71 Phosphate binding protein-like 0.0000112 1hsl A: Alignments

Protein Sequence Details

Sequence length 244
Comment arginine-binding periplasmic protein 2, putative [Edwardsiella ictaluri 93-146]
Sequence
MKKLLACAIVVACSFSAQAAENIRFASSATYPPFESLDASNNIVGFDIDLAKALCQEMKANCTFNNQAFDSLITALKFKRYDAVISGMDITPERQRQVAFTQPYYANSAIIIAQKGKYHSIADMKGLRVGMENGTTHQKYLQDKHPEIKPVAYDSYQNAILDLKNGRIDGVFGDTAVVNEWLKNNPQLAAVGEYVTDPQYFGIGLGIAVRPDNQALLHQLNQALAAIKANGTYQKISDKWFPAS

Download

Sequence (FASTA)