Domain assignment for gi|238920409|ref|YP_002933924.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 242 Periplasmic binding protein-like II 1.47e-75 Phosphate binding protein-like 0.000014 1lst A: Alignments

Protein Sequence Details

Sequence length 243
Comment arginine-binding periplasmic protein 1, putative [Edwardsiella ictaluri 93-146]
Sequence
MKKIIIAAILTGISVSATAAQTIRFAAEASYPPFEFMDAQNKMQGFDVDLANAICQQMKATCTFSNQSFDSLIPSLRFKRIDAVISSMDITPERQKQVDFSQPYYDNSALFIAEKGKVADVAALKGKRVGIQNGTTHQKYLMDKHPELTPVPYDSYQNAILDLKNGRIDAVFGDTAVVNEWMKQNPNLAPVGTKVTDADYFGTGLGIAVRKGNGPLLEQFNAALNQLKQDGQYQTIYDKWFQK

Download

Sequence (FASTA)