Domain assignment for gi|238920370|ref|YP_002933885.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
38 183 Ribonuclease H-like 5.99e-19 Transposase inhibitor (Tn5 transposase) 0.014 1mus A: Alignments

Protein Sequence Details

Sequence length 192
Comment hypothetical protein NT01EI_2480 [Edwardsiella ictaluri 93-146]
Sequence
MSDIKAERHPAIKASSRPVYLGVGTLGCTEYARCDGHFYLHKKPSCGRKNKHSRCRIYRKSQVRDARRAAKEPWLIFSSTDDFKPREIMKLYSRRMQIEQNFRDEKSEHFGCGLRASYSRSIGRMLVLSLLATLSTIVMWLLGYHAENKGLHLRYQANSIKSRRVISYLTLAENVLRHSPANLKKNGTQHRS

Download

Sequence (FASTA)