Domain assignment for gi|238920330|ref|YP_002933845.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 254 S-adenosyl-L-methionine-dependent methyltransferases 2.76e-37 UbiE/COQ5-like 0.015 2avn A:1-246 Alignments

Protein Sequence Details

Sequence length 261
Comment Methyltransferase domain protein [Edwardsiella ictaluri 93-146]
Sequence
MQDRNFDDIAEKFARNIYGTTKGRIRQAVLWQDLETLLAGLPQRPLRILDAGGGQGQIACQLAARGHRVILCDISAQMLQRAAQHAEEQGVSARMELVQSPAQEMHRHLAEPVDLVLFHAVLEWVAQPQAVLAALEKCLAPGGALSLMFYNYNGLLMLNTLVGNMEYVKLGMPKRKRRSLSPDHPLDPVQVYGWLEQLGLTISGKTGVRVFHDYLRDKTQQIGAFDDLLALEQRYCRQEPFVSLGRYIHVMAHKGDMRDPL

Download

Sequence (FASTA)