Domain assignment for gi|238920318|ref|YP_002933833.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
51 233 CheC-like 2.88e-20 CheC-like 0.022 1squ A: Alignments
252 325 Surface presentation of antigens (SPOA) 0.0000000000105 Surface presentation of antigens (SPOA) 0.013 1o6a A: Alignments

Protein Sequence Details

Sequence length 337
Comment flagellar motor switch protein FliM, putative [Edwardsiella ictaluri 93-146]
Sequence
MSDSILSQAEIDALLNGDSDAAPSEQHASLETHDGEVRPYDPTTQRRVVRERLQALEIINERFARQFRMGLFNLLRRSPDITVGAVRIQPYHEFARNLPVPTNLNLVHLKPLRGTALMVFEPSLVFMAVDNLFGGDGRFPTKVDGREFTHTEQRVIQSMLRLALDAYRDAWSAIFKLDIEYVRSEIQVKFTNITTSPNDIVVTTPFTVEVGALSGEFNICIPFSMIEPLRELLVNPPLENSKQEDQHWRDTLSKQVQHSELELVADFVDIPLRLSDVLKLQIGDVLPIDRPDRLVANVDGVPVLTCQYGCYHGQYALRVEKMINPILDATSRGNSDE

Download

Sequence (FASTA)