Domain assignment for gi|238920234|ref|YP_002933749.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
113 481 PLP-dependent transferases 8.02e-76 AAT-like 0.00033 1x0m A:26-428 Alignments
7 86 "Winged helix" DNA-binding domain 9.26e-18 GntR-like transcriptional regulators 0.028 3bwg A:5-82 Alignments

Protein Sequence Details

Sequence length 485
Comment transcriptional regulator, GntR family/aminotransferase domain protein [Edwardsiella ictaluri 93-146]
Sequence
MLSFTLDRNSPLSLQKQIYQQFHTALHDGSLQCGERLPSIRELGSKLQVSRNTITAVYEKLLQEGFIASRPGVGYNVVQASHIDLPESPAAQQELDHPPSVLCTQAPETYVDVNSPLFFSLGNPDESAFPWQRWRSWNNKASRSKHLLMTRYHPPAGLLSLRQELVKYLAGARGFHTDPQHIIITNGVQEGLALLARTLLTPQEHIAVESPCYSGAWNLFNSFAPHIHAIPVDDGGLRTDLLPEQQCALAYVTPSHQYPVGSTLPLARRLALLEWSRRSNAYVIEDDYDTTFLYGTQPLPALKSLEDANNVIYLSSFSKTLGPGMRLGFMVCPDRLVEPILNLKALWNHGASWLYQQFLADFMQDQGYHRHLRKLELEYAARQKLLREGLSALFPRARLLGTSSGLHLTLKTDLPAQRVNQLRERCLRDGVRFDTLQSMCNGSECAYMAHNGAPLMLFGFSALSEVKIRRALAIIASAAKELGLA

Download

Sequence (FASTA)