Domain assignment for gi|238920074|ref|YP_002933589.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 181 P-loop containing nucleoside triphosphate hydrolases 3.94e-49 RecA protein-like (ATPase-domain) 0.00000256 1cbu A: Alignments

Protein Sequence Details

Sequence length 181
Comment bifunctional adenosylcobalamin biosynthesis protein [Edwardsiella ictaluri 93-146]
Sequence
MILVTGGARSGKSAHVERLAAQRCARILYIATSTVTDDEMAARIEKHRAQRPAHWRTWEGYRDLGGVIRHRVRPGEGVVLECITTMLANLLYEASGGASPETLDFPALEVVLQRQVDDLIAACRASSSPVYIVTNELGMSITPENRLARHFVDIAGRANQRLAQAAQEVWLVVSGIGVQIK

Download

Sequence (FASTA)