Domain assignment for gi|238920044|ref|YP_002933559.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 83 Pili subunits 0.0000000173 Pilin 0.079 1hpw A: Alignments

Protein Sequence Details

Sequence length 112
Comment YadA-like protein, C-terminal region [Edwardsiella ictaluri 93-146]
Sequence
MQHQRDNNHHEMWQIAAKDVALAGLFQPYSVGKFNASTALGYHKDQQDVSVRMGYHFTHQLMAKADAAFNDNSLECNVGINDEFNGVRPPACPETRAGIGHQRSRNELEVRS

Download

Sequence (FASTA)